Iright
BRAND / VENDOR: Proteintech

Proteintech, 85017-4-RR, Selenoprotein P Recombinant monoclonal antibody

CATALOG NUMBER: 85017-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Selenoprotein P (85017-4-RR) by Proteintech is a Recombinant antibody targeting Selenoprotein P in WB, ELISA applications with reactivity to human samples 85017-4-RR targets Selenoprotein P in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human milk Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Selenoprotein P, also known as SEPP1, is expressed in the liver and heart and secreted into the plasma(PMID: 8421687). Selenoprotein P is implicated as an extracellular antioxidant involved in the transport of selenium to extra-hepatic tissues via apolipoprotein E receptor-2 (apoER2) and provides selenium to tissues such as brain and testis. In humans, it exists in plasma as two isoforms of approximately 50 and 60 kDa(PMID:19453253). Selenoprotein P is a glycosylated protein and deglycosylation of SEPP1 results in 45 kDa and 35 kDa isoforms(PMID: 25298198). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32952 Product name: Recombinant human Selenoprotein P protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 82-299 aa of NM_001085486.2 Sequence: SNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRS Predict reactive species Full Name: selenoprotein P, plasma, 1 Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 45-60 kDa GenBank Accession Number: NM_001085486.2 Gene Symbol: Selenoprotein P Gene ID (NCBI): 6414 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49908 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924