Proteintech, 85020-4-RR, eNOS Recombinant monoclonal antibody

Size: 20ul / 100ul The eNOS (85020-4-RR) by Proteintech is a Recombinant antibody targeting eNOS in WB, ELISA applications with reactivity to human, mouse samples 85020-4-RR targets eNOS in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: bEnd.3 cells, HUVEC cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Endothelial NOS(eNOS), also known as nitric oxide synthase 3(NOS3), has a protective function in the cardiovascular system, which is attributed to NO production. NOS3 has 3 isoforms of 68, 69, 133 kDa. Polymorphisms in NOS3 gene affects the susceptibility to several diseases such as hypertension, preeclampsia, diabetes mellitus, obesity, erectile dysfunction, and migraine. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25712 Product name: Recombinant human NOS3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-120 aa of Sequence: MGNLKSVAQEPGPPCGLGLGLGLGLCGKQGPATPAPEPSRAPASLLPPAPEHSPPSSPLTQPPEGPKFPRVKNWEVGSITYDTLSAQAQQDGPCTPRRCLGSLVFPRKLQGRPSPGPPAP Predict reactive species Full Name: nitric oxide synthase 3 (endothelial cell) Observed Molecular Weight: 140 kDa Gene Symbol: eNOS Gene ID (NCBI): 4846 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29474 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.