Iright
BRAND / VENDOR: Proteintech

Proteintech, 85022-3-RR, DOCK11 Recombinant monoclonal antibody

CATALOG NUMBER: 85022-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The DOCK11 (85022-3-RR) by Proteintech is a Recombinant antibody targeting DOCK11 in WB, IHC, ELISA applications with reactivity to human, mouse samples 85022-3-RR targets DOCK11 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, K-562 cells, RAW 264.7 cells, HEK-293 cells, Jurkat cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information DOCK11(also known as Zizimin2) is a member of CDM (Ced-5, DOCK180, and Myoblast City) family guanine nucleotide exchange factor mainly expressed in immune cells. As a guanine nucleotide exchange factor, DOCK11 activated the rho family GTPase cell division cycle 42 (CDC42), resulting in cytoskeletal reorganization. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35831 Product name: Recombinant human DOCK11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 250-400 aa of NM_144658 Sequence: HYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVETAQDDETSSQGKAENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFEEKCNKRFLVNCHDLTFNILGQIGDNAKGPPTNVEPFFINL Predict reactive species Full Name: dedicator of cytokinesis 11 Calculated Molecular Weight: 238 kDa Observed Molecular Weight: 238 kDa GenBank Accession Number: NM_144658 Gene Symbol: DOCK11 Gene ID (NCBI): 139818 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q5JSL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924