Proteintech, 85025-6-RR, Dysadherin Recombinant monoclonal antibody

Size: 20ul / 100ul The Dysadherin (85025-6-RR) by Proteintech is a Recombinant antibody targeting Dysadherin in WB, ELISA applications with reactivity to human samples 85025-6-RR targets Dysadherin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, MDA-MB-231 cells, NCI-H1299 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Dysadherin (also known as FXYD5) is a cancer-related transmembrane glycoprotein, belonging to FXYD family. It is overexpressed on the surface of many tumor cells, and promotes the movement, migration and metastasis of tumor cells by reducing E-cadherin(E- cadherin) dependent intercellular adhesion. Its main function also includes regulating the activity of na, k-ATPase. It is also a typical "abnormal migration" protein-its SDS-PAGE apparent molecular weight (35-55 kDa) is much higher than the theoretical calculation value (~20 kDa). This difference is mainly caused by extensive O- glycosylation modification, which is particularly important in cancer research, because tumor cells often show a higher degree of glycosylation (50-55 kDa), which may be related to their metastasis promoting function(PMID: 17442482;41535258). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg5715 Product name: Recombinant human FXYD5/Dysadherin protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-145 aa of NM_001164605.2 Sequence: QTLKDTTSSSSADSTIMDIQVPTRAPDAVYTELQPTSPTPTWPADETPQPQTQTQQLEGTDGPLVTDPETHKSTKAAHPTDDTTTLSERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKR Predict reactive species Full Name: FXYD domain containing ion transport regulator 5 Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 35-55 kDa GenBank Accession Number: NM_001164605.2 Gene Symbol: Dysadherin Gene ID (NCBI): 53827 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96DB9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.