Proteintech, 85029-4-RR, C1r Recombinant monoclonal antibody

Size: 20ul / 100ul The C1r (85029-4-RR) by Proteintech is a Recombinant antibody targeting C1r in WB, IHC, ELISA applications with reactivity to human, mouse samples 85029-4-RR targets C1r in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information The first component of complement is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. The serine protease subunits C1r and C1s form a Ca(2+)-dependent C1s-C1r-C1r-C1s tetramer. C1r acts by transforming the activation signal into an enzymic activity. C1r is a single-chain glycoprotein that can be cleaved into an A chain and a B chain upon activation. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag11390 Product name: Recombinant human C1R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 356-705 aa of BC035220 Sequence: AVCQDDGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSRESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVFTNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRVSVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVMEEKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAVRDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED Predict reactive species Full Name: complement component 1, r subcomponent Calculated Molecular Weight: 705 aa, 80 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC035220 Gene Symbol: C1R Gene ID (NCBI): 715 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.