Proteintech, 85030-5-RR, PDE5A Recombinant monoclonal antibody

Size: 20ul / 100ul The PDE5A (85030-5-RR) by Proteintech is a Recombinant antibody targeting PDE5A in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 85030-5-RR targets PDE5A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse lung tissue, U-251 cells Positive FC (Intra) detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information PDE5A (cGMP-binding cGMP-specific phosphodiesterase) plays a role in signal transduction by regulating the intracellular concentration of cyclic nucleotides. This phosphodiesterase catalyzes the specific hydrolysis of cGMP to 5'-GMP. Through alternative splicing, the PDE5A gene produces three proteins (PDE5A1, PDE5A2, and PDE5A3) that differ in their N termini and range in mass from 89 to 105 kDa. (PMID: 25704994; 21215707). A second 70 kDa band was consistently observed in heart tissue that either reflected a splice variant or proteolytic fragment of PDE5A. (PMID: 15576651). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18779 Product name: Recombinant human PDE5A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 321-482 aa of BC126233 Sequence: ETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTREHDANKINYMYAQYVKNTMEPLNIPDVSKDKRFPWTTENTGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENTGKVK Predict reactive species Full Name: phosphodiesterase 5A, cGMP-specific Calculated Molecular Weight: 875 aa, 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC126233 Gene Symbol: PDE5A Gene ID (NCBI): 8654 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O76074 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.