Iright
BRAND / VENDOR: Proteintech

Proteintech, 85037-5-RR, SEC22B Recombinant monoclonal antibody

CATALOG NUMBER: 85037-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SEC22B (85037-5-RR) by Proteintech is a Recombinant antibody targeting SEC22B in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat, hamster samples 85037-5-RR targets SEC22B in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, hamster samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, CHO cells, mouse brain tissue, rat brain tissue, fetal human brain tissue, human placenta tissue Positive IHC detected in: mouse liver tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Soluble N-ethylmaleimide-sensitive factor (NSF) attachment protein receptor (SNARE) proteins are critical components of the membrane fusion machinery (PMID: 20163564). SEC22B is a SNARE involved in endoplasmic reticulum (ER)/Golgi membrane trafficking. SEC22B localizes to the ER-Golgi intermediate compartment (ERGIC) and has been identified as a regulator of antigen crosspresentation (PMID: 22153078). Specification Tested Reactivity: human, mouse, rat, hamster Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag12981 Product name: Recombinant human SEC22B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-215 aa of BC001364 Sequence: VLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL Predict reactive species Full Name: SEC22 vesicle trafficking protein homolog B (S. cerevisiae) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001364 Gene Symbol: SEC22B Gene ID (NCBI): 9554 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75396 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924