Iright
BRAND / VENDOR: Proteintech

Proteintech, 85067-5-RR, Arrestin C Recombinant monoclonal antibody

CATALOG NUMBER: 85067-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Arrestin C (85067-5-RR) by Proteintech is a Recombinant antibody targeting Arrestin C in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 85067-5-RR targets Arrestin C in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse eye tissue, rat eye tissues Positive IF-P detected in: mouse eye tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)-P: IF-P : 1:500-1:2000 Background Information Arrestin C, also known as Arrestin 3 or Retinal Cone Arrestin, is a protein encoded by the ARR3 gene. It belongs to the arrestin family, which plays a crucial role in regulating G-protein-coupled receptor (GPCR) signaling and trafficking. Arrestin C is composed of two major domains: the N-domain and the C-domain, connected by a hinge region. These domains form a structure resembling two clamshells placed end-to-end. The C-terminal tail (C-tail) of Arrestin C interacts extensively with the N-domain, stabilizing its basal conformation. Arrestin C is predominantly expressed in cone photoreceptors and pinealocytes in the retina. It is involved in the shut-off mechanisms associated with high-acuity color vision by binding to phosphorylated and activated opsins, thereby inhibiting their ability to interact with transducin. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag1580 Product name: Recombinant human ARR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC012096 Sequence: MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDYVRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWMDREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVLYSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQKRGLALDGKLKHEDTNLASS Predict reactive species Full Name: arrestin 3, retinal (X-arrestin) Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 47-50 kDa GenBank Accession Number: BC012096 Gene Symbol: Arrestin C Gene ID (NCBI): 407 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P36575 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924