Iright
BRAND / VENDOR: Proteintech

Proteintech, 85074-2-RR, NME1/2 Recombinant monoclonal antibody

CATALOG NUMBER: 85074-2-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The NME1/2 (85074-2-RR) by Proteintech is a Recombinant antibody targeting NME1/2 in WB, FC (Intra), ELISA applications with reactivity to human, mouse samples 85074-2-RR targets NME1/2 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse liver tissue Positive FC (Intra) detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information NME2(non-metastatic cells 2, protein) is also named as NDKB(Nucleoside diphosphate kinase B), NM23B and belongs to the NDK family. It is involved in the phosphorylation of nucleoside diphosphates and interacts with membrane receptor and constituting a novel molecular regulatory mechanism of GPCR endocytosis. This protein has 2 isoforms produced by alternative splicing. Refer to epitope and protein detection, the antibody 85074-2-RR detects both NME1& NME2. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13913 Product name: Recombinant human NME2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC002476 Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE Predict reactive species Full Name: non-metastatic cells 2, protein (NM23B) expressed in Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 17 kDa GenBank Accession Number: BC002476 Gene Symbol: NME2 Gene ID (NCBI): 4831 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P22392 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924