Proteintech, 85089-1-RR, ASIC1 Recombinant monoclonal antibody

Size: 20ul / 100ul The ASIC1 (85089-1-RR) by Proteintech is a Recombinant antibody targeting ASIC1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85089-1-RR targets ASIC1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, mouse brain tissue, LNCaP cells, SH-SY5Y cells, rat brain tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species Full Name: amiloride-sensitive cation channel 2, neuronal Calculated Molecular Weight: 60 kDa Observed Molecular Weight: 60-70 kDa GenBank Accession Number: NM_001095 Gene Symbol: ASIC1 Gene ID (NCBI): 41 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P78348 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.