Proteintech, 85114-1-RR, HCLS1 Recombinant monoclonal antibody

Size: 20ul / 100ul The HCLS1 (85114-1-RR) by Proteintech is a Recombinant antibody targeting HCLS1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85114-1-RR targets HCLS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, mouse thymus tissue, rat thymus tissue, Ramos cells, Daudi cells, Raji cells Positive IHC detected in: mouse thymus tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEL cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Hematopoietic cell-specific Lyn substrate 1 (HS1, HCLS1, LckBP1 and p75) is a 75-kDa intracellular protein expressed in cells of lymphohemopoietic origin. It was originally identified in B-lymphocytes as a major substrate of B-cell receptor (BCR)-induced phosphorylation after antigen (Ag) stimulation. It's a substrate of the antigen receptor-coupled tyrosine kinase. HCLS1 plays a role in antigen receptor signaling for both clonal expansion and deletion in lymphoid cells. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8645 Product name: Recombinant human HCLS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 142-486 aa of BC016758 Sequence: GEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGARGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAGAGAGAVALGISAVALYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE Predict reactive species Full Name: hematopoietic cell-specific Lyn substrate 1 Calculated Molecular Weight: 486 aa, 54 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC016758 Gene Symbol: HCLS1 Gene ID (NCBI): 3059 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P14317 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.