Proteintech, 85120-1-RR, GPX8 Recombinant monoclonal antibody

Size: 20ul / 100ul The GPX8 (85120-1-RR) by Proteintech is a Recombinant antibody targeting GPX8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85120-1-RR targets GPX8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, U-87 MG cells, U2OS cells, NIH/3T3 cells, rat uterus tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1250-1:5000 Background Information GPX8(Probable glutathione peroxidase 8) is also named as GSHPx-8 and belongs to the glutathione peroxidase family. Glutathione peroxidase (GPx) reduces hydroperoxides, including hydrogen peroxides, in the presence of reduced glutathione as a means of protecting organisms from oxidative damage. Several GPx isozymes have been identified in animal cells and these have been classified into different groups according to their cellular location and substrate specificity. In humans, eight types of GPx have been identified from GPx1 to GPx8. The full length GPX8 has 209 amino acids and the molecular weight is 24 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag9930 Product name: Recombinant human GPX8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-209 aa of BC029424 Sequence: KFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL Predict reactive species Full Name: glutathione peroxidase 8 (putative) Calculated Molecular Weight: 209 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC029424 Gene Symbol: GPX8 Gene ID (NCBI): 493869 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TED1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.