Iright
BRAND / VENDOR: Proteintech

Proteintech, 85131-4-RR, STARD7 Recombinant monoclonal antibody

CATALOG NUMBER: 85131-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The STARD7 (85131-4-RR) by Proteintech is a Recombinant antibody targeting STARD7 in WB, IHC, ELISA applications with reactivity to human samples 85131-4-RR targets STARD7 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, HT-1080 cells, MCF-7 cells, K-562 cells, mouse testis tissue, rat testis tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information STARD7, also known as gestational trophoblastic tumor gene-1 (GTT1), is a lipid transfer protein that specifically binds and transports phosphatidylcholine (PC) between cellular membranes. It is a member of the START (Steroidogenic Acute Regulatory protein-related lipid transfer) domain-containing protein family, which is involved in intracellular lipid transport and metabolism. (PMID: 23507753) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8224 Product name: Recombinant human STARD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-295 aa of BC008894 Sequence: MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNEGSCGPARIEYA Predict reactive species Full Name: StAR-related lipid transfer (START) domain containing 7 Calculated Molecular Weight: 295 aa, 35 kDa Observed Molecular Weight: 34 kDa GenBank Accession Number: BC008894 Gene Symbol: STARD7 Gene ID (NCBI): 56910 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NQZ5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924