Proteintech, 85167-1-RR, PARL Recombinant monoclonal antibody

Size: 20ul / 100ul The PARL (85167-1-RR) by Proteintech is a Recombinant antibody targeting PARL in WB, ELISA applications with reactivity to human samples 85167-1-RR targets PARL in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information PARL (Presenilin associated rhomboid like), is a member of the rhomboid family of intramembrane serine proteases that is localized to the inner mitochondrial membrane. PARL has 2 isoforms produced by alternative splicing with the molecular mass of 42 kDa and 37 kDa. PARL regulates mitochondrial remodeling and apoptosis through regulated substrate proteolysis. Proteolytic processing of PARL may result in the release of a small peptide, P-beta, which may transit to the nucleus. The self-regulated cleavage of PARL at positions 52-53 (α-site) and 77--78 (β-site) produce two cleaved forms of PARL named MAMP and PACT with the molecular mass of 36 kDa and 33 kDa respectively (PMID: 14732705, 28178523). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24789 Product name: Recombinant human PARL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 56-167 aa of BC014058 Sequence: APRKVEPRRSDPGTSGEAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKEGDFRKEINKWWNNLSDGQR Predict reactive species Full Name: presenilin associated, rhomboid-like Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC014058 Gene Symbol: PARL Gene ID (NCBI): 55486 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9H300 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.