Iright
BRAND / VENDOR: Proteintech

Proteintech, 85185-4-RR, HSCB Recombinant monoclonal antibody

CATALOG NUMBER: 85185-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The HSCB (85185-4-RR) by Proteintech is a Recombinant antibody targeting HSCB in WB, ELISA applications with reactivity to human, rat samples 85185-4-RR targets HSCB in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat liver tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information HSCB, also named as HSC20 and DNAJC20, acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7268 Product name: Recombinant human HSCB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-235 aa of BC065569 Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL Predict reactive species Full Name: HscB iron-sulfur cluster co-chaperone homolog (E. coli) Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC065569 Gene Symbol: HSCB Gene ID (NCBI): 150274 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8IWL3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924