Proteintech, 85190-1-RR, Caveolin-3 Recombinant monoclonal antibody

Size: 20ul / 100ul The Caveolin-3 (85190-1-RR) by Proteintech is a Recombinant antibody targeting Caveolin-3 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 85190-1-RR targets Caveolin-3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human heart tissue, mouse colon tissue Positive IF/ICC detected in: H9C2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag28009 Product name: Recombinant human Caveolin-3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-40 aa of BC069368 Sequence: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVD Predict reactive species Full Name: caveolin 3 Calculated Molecular Weight: 151 aa, 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC069368 Gene Symbol: Caveolin-3 Gene ID (NCBI): 859 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56539 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.