Proteintech, 85308-2-RR, MARCH1 Recombinant monoclonal antibody

Size: 20ul / 100ul The MARCH1 (85308-2-RR) by Proteintech is a Recombinant antibody targeting MARCH1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85308-2-RR targets MARCH1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, Daudi cells, rat brain tissue, human skeletal muscle tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HEL cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MARCH1 is mainly found in secondary lymphoid organs, more specifically in the endocytic pathway of dendritic cells (DCs) and B cells (11-15). MARCH1 reduces the half-life of peptide/MHC II complexes by causing their redistribution from recycling endosomes to lysosomes. MARCH1 homodimerizes and also forms heterodimers with others family members (PMID: 22508929). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag20231 Product name: Recombinant human MARCH1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 222-272 aa of BC153124 Sequence: QNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGGPPEVVSV Predict reactive species Full Name: membrane-associated ring finger (C3HC4) 1 Calculated Molecular Weight: 289 aa, 32 kDa Observed Molecular Weight: 31-35 kDa GenBank Accession Number: BC153124 Gene Symbol: MARCHF1 Gene ID (NCBI): 55016 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TCQ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.