Proteintech, 85333-1-RR, GRIA1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GRIA1 (85333-1-RR) by Proteintech is a Recombinant antibody targeting GRIA1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 85333-1-RR targets GRIA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: rat cerebellum tissue, mouse brain tissue, rat brain tissue, pig brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes with multiple subunits, each possessing transmembrane regions, and all arranged to form a ligand-gated ion channel. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. This gene belongs to a family of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate (AMPA) receptors. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag21502 Product name: Recombinant human GRIA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-249 aa of BC111734 Sequence: LRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGAN Predict reactive species Full Name: glutamate receptor, ionotropic, AMPA 1 Calculated Molecular Weight: 906 aa, 102 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC111734 Gene Symbol: GRIA1 Gene ID (NCBI): 2890 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42261 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.