Proteintech, 85343-1-RR, Lumican Recombinant monoclonal antibody

Size: 20ul / 100ul The Lumican (85343-1-RR) by Proteintech is a Recombinant antibody targeting Lumican in WB, IHC, ELISA applications with reactivity to human samples 85343-1-RR targets Lumican in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, Recombinant protein, HEK-293 cells, Y79 cells, MCF-7 cells Positive IHC detected in: human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Lumican (LUM), a member of the small leucine-rich proteoglycan (SLRP) family, is one of the major extracellular components in interstitial collagenous matrices of the corneal stroma, aorta, skin, skeletal muscle, lung, kidney, bone, cartilage, and intervertebral discs. SLRPs constitute an important fraction of noncollagenous extracellular matrix proteins and have important effects on cell behavior. Lumican regulates collagenous matrix assembly as a keratan sulfate proteoglycan in the cornea and may exist as a glycoprotein in the connective tissues of other organs. Posttranslational modifications lumican goes through can increase its apparent molecular weight to 50-90 kDa. Studies show that lumican participates in the maintenance of tissue homeostasis and modulates cellular functions including cell proliferation, migration, and differentiation. (PMID: 18949819; 22252641; 9761754; 22365843) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2923 Product name: Recombinant Human Lumican protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-338 aa of NM_002345.3 Sequence: QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGPLSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN Predict reactive species Full Name: lumican Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 50-90 kDa GenBank Accession Number: NM_002345.3 Gene Symbol: Lumican Gene ID (NCBI): 4060 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P51884 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.