Iright
BRAND / VENDOR: Proteintech

Proteintech, 85344-1-RR, IFNGR1/CD119 Recombinant monoclonal antibody

CATALOG NUMBER: 85344-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The IFNGR1/CD119 (85344-1-RR) by Proteintech is a Recombinant antibody targeting IFNGR1/CD119 in WB, ELISA applications with reactivity to human samples 85344-1-RR targets IFNGR1/CD119 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, A549 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information Interferon-gamam (IFN-γ) is a cytokine critical for innate and adaptive immunity against viral and intracellular bacterial infections and for tumor control. Cellular responses to IFN-γ are activated through its interaction with a heterodimeric receptor consisting of two subunits, IFNGR1 (CD119) and IFNGR2. IFNGR1 is the ligand-binding subunit which binds IFN-γ with high affinity, whereas IFNGR2 serves as the accessory subunit. Two subunits bind one IFN-γ dimer. Defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. (PMID: 17981204; 946248; 10888113) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2999 Product name: Recombinant Human IFNGR1 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 18-245 aa of NM_000416.3 Sequence: EMGTADLGPSSVPTPTNVTIESYNMNPIVYWEYQIMPQVPVFTVEVKNYGVKNSEWIDACINISHHYCNISDHVGDPSNSLWVRVKARVGQKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIFHPSVFVNGDEQEVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVSSLNSQYCVSAEGVLHVWGVTTEKSKEVCITIFNSSIKG Predict reactive species Full Name: interferon gamma receptor 1 Calculated Molecular Weight: 54 kDa Observed Molecular Weight: 70-90 kDa GenBank Accession Number: NM_000416.3 Gene Symbol: IFNGR1 Gene ID (NCBI): 3459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15260-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924