Proteintech, 85345-1-RR, GLIPR1 Recombinant monoclonal antibody

Size: 20ul / 100ul The GLIPR1 (85345-1-RR) by Proteintech is a Recombinant antibody targeting GLIPR1 in WB, ELISA applications with reactivity to human samples 85345-1-RR targets GLIPR1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, U2OS cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GLIPR1, also known as related to testis-specific, vespid, and pathogenesis protein 1 (RTVP-1), is a membrane protein that belongs to the CAP family of cysteine-rich secretory proteins. GLIPR1 is closely associated with the development of tumors, especially GM (8,9). The high expression of GLIPR1 was found in GM cells but not in tumors or other cells of the central nervous system. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3205 Product name: Recombinant human GLIPR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-240 aa of BC012510 Sequence: SNYSHTANILPDIENEDFIKDCVRIHNKFRSEVKPTASDMLYMTWDPALAQIAKAWASNCQFSHNTRLKPPHKLHPNFTSLGENIWTGSVPIFSVSSAITNWYDEIQDYDFKTRICKKVCGHYTQVVWADSYKVGCAVQFCPKVSGFDALSNGAHFICNYGPGGNYPTWPYKRGATCSACPNNDKCLDNLCVNRQRDQVKRYYSVVYPGWPIYPRNRYTSLFLIV Predict reactive species Full Name: GLI pathogenesis-related 1 Calculated Molecular Weight: 266 aa, 30 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC012510 Gene Symbol: GLIPR1 Gene ID (NCBI): 11010 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P48060 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.