Iright
BRAND / VENDOR: Proteintech

Proteintech, 85357-1-RR, C9orf89 Recombinant monoclonal antibody

CATALOG NUMBER: 85357-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The C9orf89 (85357-1-RR) by Proteintech is a Recombinant antibody targeting C9orf89 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85357-1-RR targets C9orf89 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, C2C12 cells, H9C2 cells, rat kidney tissue, mouse kidney tissue, human placenta tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information C9orf89 (also known as CARD19 or BinCARD) is a mitochondria-localized protein that inhibits BCL10-induced NF-κB activation mainly through its caspase recruitment structural domain (CARD). It plays a role in T cell receptor (TCR) signaling, but deletion of endogenous CARD19 has a lesser effect on Bcl10-dependent NF-κB activation. In addition, C9orf89 is expressed in multiple cell types and is involved in the regulation of inflammatory and immune responses. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14084 Product name: Recombinant human C9orf89 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-183 aa of BC004500 Sequence: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNRGPMSFLAGLGLAVGLALLLYCYPPDPKGLPGTRRVLGFSPVIIDRHVSRYLLAFLADDLGGL Predict reactive species Full Name: chromosome 9 open reading frame 89 Calculated Molecular Weight: 228 aa, 26 kDa Observed Molecular Weight: 15-21 kDa GenBank Accession Number: BC004500 Gene Symbol: C9orf89 Gene ID (NCBI): 84270 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96LW7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924