Proteintech, 85389-1-RR, Cas9 Recombinant monoclonal antibody

Size: 20ul / 100ul The Cas9 (85389-1-RR) by Proteintech is a Recombinant antibody targeting Cas9 in WB, ELISA applications with reactivity to n/a samples 85389-1-RR targets Cas9 in WB, ELISA applications and shows reactivity with n/a samples. Tested Applications Positive WB detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes. This antibody detects the sp Cas9. Specification Tested Reactivity: n/a Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25281 Product name: Recombinant Cas9 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-100 aa of NP_269215 Sequence: MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKKNLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHR Predict reactive species Full Name: Cas9 Calculated Molecular Weight: 160 kDa GenBank Accession Number: NP_269215 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.