Proteintech, 85390-2-RR, FCER1G Recombinant monoclonal antibody

Size: 20ul / 100ul The FCER1G (85390-2-RR) by Proteintech is a Recombinant antibody targeting FCER1G in WB, ELISA applications with reactivity to human, mouse, pig samples 85390-2-RR targets FCER1G in WB, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: THP-1 cells, HL-60 cells, RAW 264.7 cells, pig spleen tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information FCER1G (Fc receptor gamma-chain, FcRgamma), also known as Fc-epsilon RI-gamma, or IgE Fc receptor subunit gamma (FceRI gamma), is a component of the high-affinity immunoglobulin E (IgE) receptor (Fc epsilon RI) which is a tetrameric complex of one alpha subunit, one beta subunit, and two disulfide-linked gamma subunits (PMID: 2146219; 2531187). Fc epsilon RI is present exclusively on mast cells and basophils, mediating allergic inflammatory signaling (PMID: 17438574). FCER1G is widely expressed and contains an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors (PMID: 19098920). Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4442 Product name: Recombinant human FCER1G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC033872 Sequence: MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKVIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ Predict reactive species Full Name: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide Calculated Molecular Weight: 87 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC033872 Gene Symbol: FcRγ Gene ID (NCBI): 2207 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.