Proteintech, 85403-1-RR, Cystatin SN/CST1 Recombinant monoclonal antibody

Size: 20ul / 100ul The Cystatin SN/CST1 (85403-1-RR) by Proteintech is a Recombinant antibody targeting Cystatin SN/CST1 in WB, ELISA applications with reactivity to human samples 85403-1-RR targets Cystatin SN/CST1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, human saliva Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CST1, or cystatin SN, is a gene in humans that encodes a secreted protein belonging to the type 2 cystatin superfamily, which includes CST1, CST2, CST3, CST4, and CST5. These proteins are cysteine proteinase inhibitors found in various human fluids and secretions, where they appear to provide protective functions . CST1 is specifically found in saliva, tears, urine, and seminal fluid, and it plays a role in inhibiting the activity of cysteine proteases. CST1 has been implicated in various pathological processes, including tumor invasion and metastasis. Overexpression of CST1 has been observed in several types of cancer, such as lung, breast, colorectal, and gastric cancer, suggesting its role in the proliferation, invasion, and metastasis of these tumors. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag8862 Product name: Recombinant human CST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-141 aa of BC021225 Sequence: KEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES Predict reactive species Full Name: cystatin SN Calculated Molecular Weight: 141 aa, 16 kDa Observed Molecular Weight: 14-16 kDa GenBank Accession Number: BC021225 Gene Symbol: CST1 Gene ID (NCBI): 1469 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01037 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.