Iright
BRAND / VENDOR: Proteintech

Proteintech, 85408-5-RR, PARN Recombinant monoclonal antibody

CATALOG NUMBER: 85408-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PARN (85408-5-RR) by Proteintech is a Recombinant antibody targeting PARN in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85408-5-RR targets PARN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Jurkat cells, MDA-MB-453 cells, HeLa cells, HEK-293T cells, HepG2 cells, PC-12 cells, NIH/3T3 cells Positive IHC detected in: Human Breast Cancer(Her2+;ER-;PR-)Note: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Poly(A)-specific ribonuclease (PARN) is a deadenylase enzyme that is present in mammalian cells. As a deadenylase, PARN interacts with the cap and the poly(A) tail of mRNA to control the length of the poly(A) tail and regulate gene expression. Therefore, it plays a role in mRNA degradation in the nucleus and cytoplasm. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4774 Product name: Recombinant human PARN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-347 aa of BC050029 Sequence: MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELE Predict reactive species Full Name: poly(A)-specific ribonuclease (deadenylation nuclease) Calculated Molecular Weight: 639 aa, 73 kDa Observed Molecular Weight: 74 kDa GenBank Accession Number: BC050029 Gene Symbol: PARN Gene ID (NCBI): 5073 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95453 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924