Proteintech, 85422-1-RR, HNRNPM Recombinant monoclonal antibody

Size: 20ul / 100ul The HNRNPM (85422-1-RR) by Proteintech is a Recombinant antibody targeting HNRNPM in WB, IF/ICC, ELISA applications with reactivity to human samples 85422-1-RR targets HNRNPM in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, COLO 320 cells, MCF-7 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information HNRNPM, also named as NAGR1, is a 730 amino acid protein, which localizes in nucleus. HNRNPM as a pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. HNRNPM is Involved in splicing. HNRNPM acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. HNRNPM exists three isoforms MW range form 73 kDa and 77 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25474 Product name: Recombinant human HNRNPM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of BC000138 Sequence: MAAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKE Predict reactive species Full Name: heterogeneous nuclear ribonucleoprotein M Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 73-77 kDa GenBank Accession Number: BC000138 Gene Symbol: HNRNPM Gene ID (NCBI): 4670 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P52272 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.