Iright
BRAND / VENDOR: Proteintech

Proteintech, 85428-5-RR, ILK Recombinant monoclonal antibody

CATALOG NUMBER: 85428-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ILK (85428-5-RR) by Proteintech is a Recombinant antibody targeting ILK in WB, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, pig samples 85428-5-RR targets ILK in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: K-562 cells, pig colon tissue, HeLa cells, HEK-293 cells, mouse brain tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ILK(Integrin-linked protein kinase) is also named as p59, PAT-4, DKFZp686F1765, ILK-1, ILK-2, ILK1, ILK2, p59ILK and belongs to the TKL Ser/Thr protein kinase family. This protein localizes to multiple sites, including the cytoplasm, and imports into the nucleus through sequences in its N-terminus, via active transport mechanisms that involve nuclear pore complexes(PMID: 18635968). ILK performs crucial roles in the control of intestinal cell and crypt-villus axis homeostasis-especially with regard to basement membrane fibronectin deposition-as well as cell proliferation, spreading, and migration(PMID:19885839). Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3570 Product name: Recombinant human ILK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 102-451 aa of BC001554 Sequence: VPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQD Predict reactive species Full Name: integrin-linked kinase Calculated Molecular Weight: 451 aa, 59 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC001554 Gene Symbol: ILK Gene ID (NCBI): 3611 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13418 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924