Iright
BRAND / VENDOR: Proteintech

Proteintech, 85430-4-RR, BRCC3 Recombinant monoclonal antibody

CATALOG NUMBER: 85430-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The BRCC3 (85430-4-RR) by Proteintech is a Recombinant antibody targeting BRCC3 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 85430-4-RR targets BRCC3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SK-BR-3 cells, HeLa cells, HEK-293T cells, MCF-7 cells, HT-29 cells, Neuro-2a cells, HSC-T6 cells Positive IP detected in: SK-BR-3 cells Positive IHC detected in: human ovary cancer tissue, Human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information BRCA1-BRCA2-containing complex subunit 3 (BRCC3), a Lys-63-specific deubiquitinase, is a member of the JAMM/MPN family of zinc metalloproteases. BRCC3 have been shown to promote the inflammasome activation by deubiquitinating NOD-like receptor containing pyrin domain 3 (NLRP3). BRCC3 is associated with G2/M arrest in breast cancer cells and DNA damage. The expression of BRCC3 is associated with increased cell proliferation. (PMID: 23246432, PMID: 30272359) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag7584 Product name: Recombinant human BRCC3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-316 aa of BC002999 Sequence: LESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE Predict reactive species Full Name: BRCA1/BRCA2-containing complex, subunit 3 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002999 Gene Symbol: BRCC3 Gene ID (NCBI): 79184 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924