Iright
BRAND / VENDOR: Proteintech

Proteintech, 85432-4-RR, CTR9 Recombinant monoclonal antibody

CATALOG NUMBER: 85432-4-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CTR9 (85432-4-RR) by Proteintech is a Recombinant antibody targeting CTR9 in WB, ELISA applications with reactivity to human, mouse, rat samples 85432-4-RR targets CTR9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, L02 cells, mouse lung tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information CTR9, also named as KIAA0155 and SH2BP1, contains 16 TPR repeats. It is widely expressed. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag15690 Product name: Recombinant human CTR9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-338 aa of BC058914 Sequence: MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEFVKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMADKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYRGALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAVLELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTEVEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASS Predict reactive species Full Name: Ctr9, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) Calculated Molecular Weight: 1173 aa, 134 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC058914 Gene Symbol: CTR9 Gene ID (NCBI): 9646 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6PD62 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924