Proteintech, 85438-4-RR, CHGB Recombinant monoclonal antibody

Size: 20ul / 100ul The CHGB (85438-4-RR) by Proteintech is a Recombinant antibody targeting CHGB in WB, IHC, ELISA applications with reactivity to human samples 85438-4-RR targets CHGB in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, BxPC-3 cells, SH-SY5Y cells, RAW 264.7 cells, PC-12 cells, HEK-293T cells Positive IHC detected in: human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Chromogranin B is also named as Secretogranin-1, SgI, CgB, CHGB and SCG1. CHGB, a secretory granule protein, inserts itself into membrane and forms a chloride-conducting channel (PMID: 30456382). Native CHGB distributes nearly equally in soluble and membrane-bound forms, and both reconstitute highly selective anion channels in membrane (PMID: 37435575). The calculated molecular weight of Chromogranin B is at 78kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag6833 Product name: Recombinant human CHGB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 328-677 aa of BC000375 Sequence: HSTHYRASEEEPEYGEEIKGYPGVQAPEDLEWERYRGRGSEEYRAPRPQSEESWDEEDKRNYPSLELDKMAHGYGEESEEERGLEPGKGRHHRGRGGEPRAYFMSDTREEKRFLGEGHHRVQENQMDKARRHPQGAWKELDRNYLNYGEEGAPGKWQQQGDLQDTKENREEARFQDKQYSSHHTAEKRKRLGELFNPYYDPLQWKSSHFERRDNMNDNFLEGEEENELTLNEKNFFPEYNYDWWEKKPFSEDVNWGYEKRNLARVPKLDLKRQYDRVAQLDQLLHYRKKSAEFPDFYDSEEPVSTHQEAENEKDRADQTVLTEDEKKELENLAAMDLELQKIAEKFSQRG Predict reactive species Full Name: chromogranin B (secretogranin 1) Calculated Molecular Weight: 78 kDa Observed Molecular Weight: 70-100 kDa GenBank Accession Number: BC000375 Gene Symbol: Chromogranin B Gene ID (NCBI): 1114 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05060 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.