Proteintech, 85446-2-RR, HPGDS Recombinant monoclonal antibody

Size: 20ul / 100ul The HPGDS (85446-2-RR) by Proteintech is a Recombinant antibody targeting HPGDS in WB, ELISA applications with reactivity to human samples 85446-2-RR targets HPGDS in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Hematopoietic PGD synthase (HPGDS), one of the PGD2 synthases, is distributed in the cytoplasm of mast cells and Th2 cells and catalyzes PGD2 production during inflammation and allergic reactions. HPGDS belongs to the gene family of σ-type glutathione S-transferase (GST). Like other GSTs, it exists as a homodimer in vivo with a molecular weight of approximately 52 kDa (PMID: 38339125). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag18290 Product name: Recombinant human PGDS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-199 aa of BC020734 Sequence: MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL Predict reactive species Full Name: prostaglandin D2 synthase, hematopoietic Calculated Molecular Weight: 199 aa, 23 kDa Observed Molecular Weight: 26 kDa, 52 kDa GenBank Accession Number: BC020734 Gene Symbol: HPGDS Gene ID (NCBI): 27306 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O60760 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.