Proteintech, 85606-5-RR, CXCL5 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCL5 (85606-5-RR) by Proteintech is a Recombinant antibody targeting CXCL5 in WB, ELISA applications with reactivity to human samples 85606-5-RR targets CXCL5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: TNF alpha, PMA and BSA treated A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Chemokines are a class of pro-inflammatory cytokines that can recruit and activate chemotactic cells. CXCL5 is a member of the chemokine family binding CXCR2, a G-protein coupled receptor. CXCL5 is a chemokine that promotes tumor formation by triggering the migration of immune cells to tumors and promotes immmuno-suppressive characteristics of the tumor microenvironment. CXCL5 can also promote tumor cell metastasis and recruit vascular endothelial cells for angiogenesis. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2939 Product name: Recombinant Human CXCL5 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 37-114 aa of NM_002994.4 Sequence: AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN Predict reactive species Full Name: chemokine (C-X-C motif) ligand 5 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 10-12 kDa GenBank Accession Number: NM_002994.4 Gene Symbol: CXCL5 Gene ID (NCBI): 6374 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P42830 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.