Proteintech, 85647-1-RR, CXCL4/PF4 Recombinant monoclonal antibody

Size: 20ul / 100ul The CXCL4/PF4 (85647-1-RR) by Proteintech is a Recombinant antibody targeting CXCL4/PF4 in WB, ELISA applications with reactivity to human, mouse samples 85647-1-RR targets CXCL4/PF4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse serum, human peripheral blood platelets Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2129 Product name: Recombinant Human CXCL4/PF4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 32-101 aa of NM_002619.4 Sequence: EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES Predict reactive species Full Name: platelet factor 4 Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_002619.4 Gene Symbol: PF4 Gene ID (NCBI): 5196 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02776 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.