Proteintech, 85651-2-RR, IQGAP1 Recombinant monoclonal antibody

Size: 20ul / 100ul The IQGAP1 (85651-2-RR) by Proteintech is a Recombinant antibody targeting IQGAP1 in WB, ELISA applications with reactivity to human, mouse, rat samples 85651-2-RR targets IQGAP1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, MCF-7 cells, HeLa cells, K-562 cells, NIH/3T3 cells, HSC-T6 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information IQGAP1 is a member of a family of scaffolding proteins that interact with signaling and structural molecules. It localizes to sites of cell-cell contact in epithelial cells and regulates distinct cellular processes including cell adhesion, cell migration, extracellular signals through interacting with numerous protein. Multiple studies have shown that IQGAP1 is up-regulated in many human malignancies, such as lung cancer, ovarian cancer, colon cancer, breast cancer, melanoma and HCC. And IQGAP1 plays a critical role in cancer cell invasion. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag19321 Product name: Recombinant human IQGAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 478-827 aa of BC151834 Sequence: QLSSSVTGLTNIEEENCQRYLDELMKLKAQAHAENNEFITWNDIQACVDHVNLVVQEEHERILAIGLINEALDEGDAQKTLQALQIPAAKLEGVLAEVAQHYQDTLIRAKREKAQEIQDESAVLWLDEIQGGIWQSNKDTQEAQKFALGIFAINEAVESGDVGKTLSALRSPDVGLYGVIPECGETYHSDLAEAKKKKLAVGDNNSKWVKHWVKGGYYYYHNLETQEGGWDEPPNFVQNSMQLSREEIQSSISGVTAAYNREQLWLANEGLITRLQARCRGYLVRQEFRSRMNFLKKQIPAITCIQSQWRGYKQKKAYQDRLAYLRSHKDEVVKIQSLARMHQARKRYRD Predict reactive species Full Name: IQ motif containing GTPase activating protein 1 Calculated Molecular Weight: 189 kDa Observed Molecular Weight: 190-195 kDa GenBank Accession Number: BC151834 Gene Symbol: IQGAP1 Gene ID (NCBI): 8826 ENSEMBL Gene ID: ENSG00000140575 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46940 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.