Iright
BRAND / VENDOR: Proteintech

Proteintech, 85657-5-RR, Mammaglobin A Recombinant monoclonal antibody

CATALOG NUMBER: 85657-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Mammaglobin A (85657-5-RR) by Proteintech is a Recombinant antibody targeting Mammaglobin A in WB, ELISA applications with reactivity to human samples 85657-5-RR targets Mammaglobin A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, MDA-MB-231 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information SCGB2A2, also known as mammaglobin A, is a member of the secretoglobin superfamily. It is a breast cancer-associated antigen almost exclusively over-expressed in primary and metastatic human breast cancers, making it a specific molecular marker and a potential therapeutic target for breast cancer. SCGB2A2 is a 93-amino acid protein with a calculated molecular weight of 10.5 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2887 Product name: Recombinant Human Mammaglobin A protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-93 aa of NM_002411.3 Sequence: GSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATTNAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF Predict reactive species Full Name: secretoglobin, family 2A, member 2 Calculated Molecular Weight: 10 kDa Observed Molecular Weight: 6-10 kDa GenBank Accession Number: NM_002411.3 Gene Symbol: Mammaglobin A Gene ID (NCBI): 4250 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13296-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924