Proteintech, 85667-6-RR, Apolipoprotein A II/APOA2 Recombinant monoclonal antibody

Size: 20ul / 100ul The Apolipoprotein A II/APOA2 (85667-6-RR) by Proteintech is a Recombinant antibody targeting Apolipoprotein A II/APOA2 in WB, ELISA applications with reactivity to human samples 85667-6-RR targets Apolipoprotein A II/APOA2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Apolipoprotein A-II (APOA2) is a major component of high density lipoprotein (HDL) and it plays an important role in directing the fate of lipid metabolism among HDL. It is primarily synthesized by liver. The predicted MW of ApoA2 is 11 kDa, while the mature form is smaller (7-10 kDa) since the signal peptide was cleaved. In humans, most of circulating apoA2 exist as dimer. Five types of APOA2 dimer exist: homodimer apoA2-ATQ/ATQ, heterodimer apoA2-ATQ/AT, homodimer apoA2-AT/AT, apoA2-AT/A, and apoA2-A/A. ApoA2 isoforms are considered to be some of the most promising serum/plasma biomarkers for aiding the early detection of pancreatic cancer. (PMID: 29081441, 29481802) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3085 Product name: Recombinant Human Apolipoprotein A II protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 19-100 aa of NM_001643.1 Sequence: ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ Predict reactive species Full Name: apolipoprotein A-II Calculated Molecular Weight: 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: NM_001643.1 Gene Symbol: APOA2 Gene ID (NCBI): 336 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02652 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.