Iright
BRAND / VENDOR: Proteintech

Proteintech, 85676-3-RR, RBPJ Recombinant monoclonal antibody

CATALOG NUMBER: 85676-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The RBPJ (85676-3-RR) by Proteintech is a Recombinant antibody targeting RBPJ in WB, ELISA applications with reactivity to human, rat samples 85676-3-RR targets RBPJ in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cell, HEK-293 cells, Jurkat cells, MCF-7 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information RBPJ, also named as IGKJRB, IGKJRB1, RBPJK, RBPSUH, NY-REN-30, CBF-1 and CSL, belongs to the Su(H) family. It is a transcriptional regulator that plays a central role in Notch signaling, a signaling pathway involved in cell-cell communication that regulates a broad spectrum of cell-fate determinations. RBPJ acts as a transcriptional repressor when it is not associated with Notch proteins. It is specifically binds to the immunoglobulin kappa-type J segment recombination signal sequence. RBPJ binds to the Runx3 promoter in the atrioventricular canal in vivo, and inhibition of Notch reduces RUNX3 expression in the cardiac cushion of embryonic hearts. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag32552 Product name: Recombinant human RBPJ protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-486 aa of BC064976 Sequence: MYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS Predict reactive species Full Name: recombination signal binding protein for immunoglobulin kappa J region Calculated Molecular Weight: 56 kDa Observed Molecular Weight: ~60 kDa GenBank Accession Number: BC064976 Gene Symbol: RBPJ Gene ID (NCBI): 3516 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q06330 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924