Proteintech, 85677-1-RR, CD90 Recombinant monoclonal antibody

Size: 20ul / 100ul The CD90 (85677-1-RR) by Proteintech is a Recombinant antibody targeting CD90 in WB, ELISA applications with reactivity to mouse, rat samples 85677-1-RR targets CD90 in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, EL-4 cells, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information CD90 (Thy-1) is a 25 kDa, GPI-linked membrane glycoprotein that belongs to the immunoglobulin superfamily (PMID: 6177036; 6153212). Originally described as a brain thymus cross-reactive antigen, it is found in large quantities on mouse and rat thymocytes and central nervous system cells (PMID: 83175). CD90 has been postulated to be involved in cellular recognition, adherence, and T-cell activation (PMID: 7683034). Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg1380 Product name: Recombinant Mouse CD90/Thy1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 20-131 aa of NM_009382.3 Sequence: QKVTSLTACLVNQNLRLDCRHENNTKDNSIQHEFSLTREKRKHVLSGTLGIPEHTYRSRVTLSNQPYIKVLTLANFTTKDEGDYFCELQVSGANPMSSNKSISVYRDKLVKC Predict reactive species Full Name: thymus cell antigen 1, theta Calculated Molecular Weight: 18kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_009382.3 Gene Symbol: CD90 Gene ID (NCBI): 21838 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P01831 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.