Iright
BRAND / VENDOR: Proteintech

Proteintech, 85689-5-RR, Tetranectin Recombinant monoclonal antibody

CATALOG NUMBER: 85689-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The Tetranectin (85689-5-RR) by Proteintech is a Recombinant antibody targeting Tetranectin in WB, IHC, ELISA applications with reactivity to human samples 85689-5-RR targets Tetranectin in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information C-Type Lectin Domain Family 3 Member B (CLEC3B) is a transmembrane Ca2+-binding protein, locating in cell plasma, extracellular matrix and exosomes. Downregulation of CLEC3B has been reported in various diseases. It was demonstrated in CLEC3B-deficient mice that the absence of CLEC3B impeded the mineralization process in osteogenesis. (PMID: 31477130) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3063 Product name: Recombinant Human CLEC3B protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-202 aa of NM_003278.2 Sequence: EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVCLKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Predict reactive species Full Name: C-type lectin domain family 3, member B Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: NM_003278.2 Gene Symbol: CLEC3B Gene ID (NCBI): 7123 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924