Iright
BRAND / VENDOR: Proteintech

Proteintech, 85690-5-RR, CYP17A1 Recombinant monoclonal antibody

CATALOG NUMBER: 85690-5-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The CYP17A1 (85690-5-RR) by Proteintech is a Recombinant antibody targeting CYP17A1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 85690-5-RR targets CYP17A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue Positive IHC detected in: mouse testis tissue, rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Cytochrome P450 17A1 (CYP17A1) is a critical steroidogenic enzyme, essential for producing glucocorticoids and sex hormones (PMID: 33781841). The CYP17A1 gene is expressed in the adrenal cortex and the gonads but not in the placenta (PMID: 19403566). Although CYP17A1 has been shown to be a 50-kDa protein, the presence of a lower molecular mass(30 kDa) immunoreactive form in rat Leydig cells was previously shown and it is either a degradation product or a truncated form of the 50 kDa enzyme (PMID: 15761033). Defects in CYP17A1 are the cause of adrenal hyperplasia type 5 (AH5) and CYP17A1 is an important target for inhibition in the treatment of prostate cancer (PMID: 27505042). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5899 Product name: Recombinant human CYP17A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 160-508 aa of BC062997 Sequence: HNGQSIDISFPVFVAVTNVISLICFNTSYKNGDPELNVIQNYNEGIIDNLSKDSLVDLVPWLKIFPNKTLEKLKSHVKIRNDLLNKILENYKEKFRSDSITNMLDTLMQAKMNSDNGNAGPDQDSELLSDNHILTTIGDIFGAGVETTTSVVKWTLAFLLHNPQVKKKLYEEIDQNVGFSRTPTISDRNRLLLLEATIREVLRLRPVAPMLIPHKANVDSSIGEFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLNPAGTQLISPSVSYLPFGAGPRSCIGEILARQELFLIMAWLLQRFDLEVPDDGQLPSLEGIPKVVFLIDSFKVKIKVRQAWREAQAEGST Predict reactive species Full Name: cytochrome P450, family 17, subfamily A, polypeptide 1 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 50-57 kDa GenBank Accession Number: BC062997 Gene Symbol: CYP17A1 Gene ID (NCBI): 1586 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05093 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924