Proteintech, 85719-4-RR, C1QA Recombinant monoclonal antibody

Size: 20ul / 100ul The C1QA (85719-4-RR) by Proteintech is a Recombinant antibody targeting C1QA in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 85719-4-RR targets C1QA in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue, mouse lung tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The first component of complement, C1, is a calcium-dependent complex of the 3 subcomponents C1q, C1r, and C1s. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. This antibody is raised against C1qA which is the A-chain polypeptide of human complement subcomponent C1q. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2396 Product name: Recombinant Human C1QA protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 23-245 aa of NM_015991.4 Sequence: EDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA Predict reactive species Full Name: complement component 1, q subcomponent, A chain Calculated Molecular Weight: 26kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: NM_015991.4 Gene Symbol: C1QA Gene ID (NCBI): 712 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02745 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.