Proteintech, 85737-4-RR, Decorin Recombinant monoclonal antibody

Size: 20ul / 100ul The Decorin (85737-4-RR) by Proteintech is a Recombinant antibody targeting Decorin in WB, ELISA applications with reactivity to mouse, rat samples 85737-4-RR targets Decorin in WB, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: mouse skin tissue, mouse uterus tissue, mouse heart tissue, mouse colon tissue, rat colon tissue, rat uterus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Decorin is a member of the small leucine-rich proteoglycan family of proteins. Decorin interacts with type I collagen fibrils, thereby influencing the kinetics of fibril formation and the distance between adjacent collagen fibrils. The binding of this protein to multiple cell surface receptors mediates its role in tumor suppression, including a stimulatory effect on autophagy and inflammation and an inhibitory effect on angiogenesis and tumorigenesis. Decorin(~ 40 kDa) also binds glycosaminoglycan chains to form big molecules. Specification Tested Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2955 Product name: Recombinant Mouse Decorin protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 17-354 aa of NM_001190451.2 Sequence: GPFEQRGLFDFMLEDEASGIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK Predict reactive species Full Name: decorin Calculated Molecular Weight: 40 kDa Observed Molecular Weight: 45-100 kDa GenBank Accession Number: NM_001190451.2 Gene Symbol: Dcn Gene ID (NCBI): 13179 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P28654 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.