Proteintech, 85743-2-RR, PELO Recombinant monoclonal antibody

Size: 20ul / 100ul The PELO (85743-2-RR) by Proteintech is a Recombinant antibody targeting PELO in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85743-2-RR targets PELO in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, SKOV-3 cells, A375 cells, MDA-MB-231 cells, HEK-293 cells, mouse testis tissue, rat testis tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085]. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0873 Product name: Recombinant human PELO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-384 aa of BC005889 Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE Predict reactive species Full Name: pelota homolog (Drosophila) Calculated Molecular Weight: 43 kDa Observed Molecular Weight: 43-45 kDa GenBank Accession Number: BC005889 Gene Symbol: PELO Gene ID (NCBI): 53918 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9BRX2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.