Proteintech, 85754-4-RR, IL-12A/IL-12 p35 Recombinant monoclonal antibody

Size: 20ul / 100ul The IL-12A/IL-12 p35 (85754-4-RR) by Proteintech is a Recombinant antibody targeting IL-12A/IL-12 p35 in WB, IF/ICC, ELISA applications with reactivity to human samples 85754-4-RR targets IL-12A/IL-12 p35 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Recombinant protein Positive IF/ICC detected in: IFN gamma and LPS treated THP-1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information IL-12A (Interleukin-12A) is a subunit of the cytokine IL-12, which is also known as IL-12 p35. IL-12 is a heterodimeric cytokine composed of two subunits: IL-12A (p35) and IL-12B (p40). This cytokine plays a crucial role in the immune response, particularly in the activation and differentiation of T cells and natural killer (NK) cells. This antibody recognizes IL-12A and IL-12 P70, which consists of IL-12A and B, but does not recognize IL-12B. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3341 Product name: Recombinant Human IL12A protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-219 aa of BC104982 Sequence: RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS Predict reactive species Full Name: interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC104982 Gene Symbol: IL-12A Gene ID (NCBI): 3592 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P29459 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.