Iright
BRAND / VENDOR: Proteintech

Proteintech, 85779-1-RR, ADORA1 Recombinant monoclonal antibody

CATALOG NUMBER: 85779-1-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The ADORA1 (85779-1-RR) by Proteintech is a Recombinant antibody targeting ADORA1 in WB, ELISA applications with reactivity to human samples 85779-1-RR targets ADORA1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information ADORA1, also known as RDC7, is a receptor for adenosine. It is mediated by G proteins, which inhibit adenylyl cyclase. Adenosine is an important mediator of ethanol intoxication and exerts some of its effects via ADORA1 in the central nervous system. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag14092 Product name: Recombinant human ADORA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-243 aa of BC026340 Sequence: NFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALILFLF Predict reactive species Full Name: adenosine A1 receptor Calculated Molecular Weight: 326 aa, 37 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC026340 Gene Symbol: Adenosine A1 Receptor Gene ID (NCBI): 134 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30542 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924