Proteintech, 85800-7-RR, hCG Beta Recombinant monoclonal antibody

Size: 20ul / 100ul The hCG Beta (85800-7-RR) by Proteintech is a Recombinant antibody targeting hCG Beta in WB, IHC, ELISA applications with reactivity to human samples 85800-7-RR targets hCG Beta in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: JAR cells, human placenta tisse Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Beta-hCG (beta-human chorionic gonadotropin) is a glycoprotein hormone produced by the placenta during pregnancy. It is a critical marker used in both obstetrics and oncology for various diagnostic and monitoring purposes. hCG is composed of two subunits: an alpha subunit (similar to other glycoprotein hormones like LH, FSH, and TSH) and a unique beta subunit (β-hCG). The beta subunit is the primary focus for diagnostic tests due to its specificity. β-hCG is initially secreted by the syncytiotrophoblast cells surrounding the developing embryo and later by the placenta. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3378 Product name: Recombinant Human hCG Beta protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 21-165 aa of Sequence: SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ Predict reactive species Full Name: CG beta Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 20-25 kDa Gene Symbol: hCG Beta Gene ID (NCBI): 1082 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P0DN86 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.