Proteintech, 85800-9-RR, hCG Alpha Recombinant monoclonal antibody

Size: 20ul / 100ul The hCG Alpha (85800-9-RR) by Proteintech is a Recombinant antibody targeting hCG Alpha in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 85800-9-RR targets hCG Alpha in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Hydroxyurea treated JAR cells Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: Hydroxyurea treated JAR cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Human chorionic gonadotropin (hCG) is a heterodimeric glycoprotein hormone consisting of two non-covalently linked subunits: a common α-subunit (hCGα) and a hormone-specific β-subunit (hCGβ). The α-subunit, also designated CGA (chorionic gonadotropin alpha chain), is a 92-amino-acid glycopeptide of ~14-22 kDa that is identical to the α-subunits of the pituitary glycoprotein hormones luteinizing hormone (LH), follicle-stimulating hormone (FSH), and thyroid-stimulating hormone (TSH). Because the α-subunit is shared among these hormones, its biological specificity is conferred by the unique β-subunit with which it associates. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg3377 Product name: Recombinant Human hCG Alpha protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 25-116 aa of Sequence: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Predict reactive species Full Name: CG beta Calculated Molecular Weight: 18 kDa Observed Molecular Weight: 20 kDa Gene Symbol: hCG Beta Gene ID (NCBI): 1082 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P0DN86(CGB)+P01215(CGA) Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.