Proteintech, 85801-5-RR, MEF2D Recombinant monoclonal antibody

Size: 20ul / 100ul The MEF2D (85801-5-RR) by Proteintech is a Recombinant antibody targeting MEF2D in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 85801-5-RR targets MEF2D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, THP-1 cells, K-562 cells, U2OS cells, C2C12 cells, C6 cells, U266 cells Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information MEF2D, also named as Myocyte-specific enhancer factor 2D, is a 521 amino acid protein, which belongs to the MEF2 family. MEF2D is expressed in t in myotubes and also in undifferentiated myoblasts. MEF2D as a transcriptional activator which binds specifically to the MEF2 element, found in numerous muscle-specific and stress-induced genes. MEF2D mediates cellular functions not only in skeletal and cardiac muscle development, but also in neuronal differentiation and survival. The calculated molecular weight of MEF2D is 55 kDa, but Phosphorylated MEF2D is 60 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5700 Product name: Recombinant human MEF2D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-514 aa of BC040949 Sequence: SLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVGNGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHSTQLGAPSRKPDLRVITSQAGKGLMHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFSSPGGLSLGNVTAWQQPQQPQQPQQPQPPQQQPPQPQQPQPQQPQQPQQPPQQQSHLVPVSLSNLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGDGLSSPAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK Predict reactive species Full Name: myocyte enhancer factor 2D Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 55-60 kDa GenBank Accession Number: BC040949 Gene Symbol: MEF2D Gene ID (NCBI): 4209 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q14814 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.