Product Description
Size: 20ul / 100ul
The IL-19 (85817-2-RR) by Proteintech is a Recombinant antibody targeting IL-19 in WB, ELISA applications with reactivity to mouse samples
85817-2-RR targets IL-19 in WB, ELISA applications and shows reactivity with mouse samples.
Tested Applications
Positive WB detected in: Recombinant protein
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
IL-19, a member of the IL-10 cytokine family (IL-10, -19, -20, -22, -24, -26, -28, and -29), is expressed in epithelial cells, endothelial cells, and macrophages. It can bind the interleukin-20 receptor complex IL-20R1/IL-20R2 and lead to the activation of the signal transducer and activator of transcription 3 (STAT3). IL-19 induces IL-6 and TNF-α production in monocytes. It also induces cell apoptosis and reactive oxygen species production in monocytes, which suggests a role of this cytokine in inflammatory responses. It is up-regulated in monocytes following stimulation with lipopolysaccharide (LPS), and granulocyte-macrophage colony-stimulating factor (GM-CSF). IL-19 alters the balance of Th1 and Th2 cells in favor of Th2 cells. IL-19 contributes to a range of diseases and disorders, such as breast cancer, squamous cell carcinoma of the skin, asthma, endotoxic shock, uremia, psoriasis, rheumatoid arthritis, and periodontal and vascular disease.
Specification
Tested Reactivity: mouse
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Eg2844 Product name: Recombinant Mouse IL-19 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-176 aa of NM_001009940.1 Sequence: LRRCLISVDMRLIEKSFHEIKRAMQTKDTFKNVTILSLENLRSIKPGDVCCMTNNLLTFYRDRVFQDHQERSLEVLRRISSIANSFLCVQKSLERCQVHRQCNCSQEATNATRIIHDNYNQLEVSSAALKSLGELNILLAWIDRNHLETPAA Predict reactive species
Full Name: interleukin 19
Calculated Molecular Weight: 20 kDa
GenBank Accession Number: NM_001009940.1
Gene Symbol: Il19
Gene ID (NCBI): 329244
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: Q8CJ70
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924